PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10027178m
Common NameCARUB_v10027178mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 195aa    MW: 22117.1 Da    PI: 5.311
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10027178mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY86.81.9e-27109167159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      +dDg++WrKYG+K+vk++ + r+YY+C+s+gC+vkk+ver+ ed  +v++tY g Hnhe
  Carubv10027178m 109 MDDGFKWRKYGKKSVKNNINKRNYYKCSSEGCSVKKRVERDGEDAAYVITTYDGVHNHE 167
                      59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.2E-3096169IPR003657WRKY domain
SuperFamilySSF1182909.02E-26101169IPR003657WRKY domain
PROSITE profilePS5081128.495104169IPR003657WRKY domain
SMARTSM007741.8E-30109168IPR003657WRKY domain
PfamPF031061.2E-21110167IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MNISQSPNFT YFSDESFINP FMDNNDFSNL MFFDVDEEGG NNNGFVEEEI SSPTSIVSSE  60
TFTGESGGSG SATTLFKKES TNRGIKESDQ TKDTGHRVAF RTRSKIDVMD DGFKWRKYGK  120
KSVKNNINKR NYYKCSSEGC SVKKRVERDG EDAAYVITTY DGVHNHESPS HVYYNDMVLS  180
YDHDNWNQHS LLHC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-2399170778Probable WRKY transcription factor 4
2lex_A1e-2399170778Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4938130.0AB493813.1 Arabidopsis thaliana At5g64810 mRNA for hypothetical protein, partial cds, clone: RAAt5g64810.
GenBankAF4262520.0AF426252.1 Arabidopsis thaliana WRKY transcription factor 51 (WRKY51) mRNA, complete cds.
GenBankBT0257550.0BT025755.1 Arabidopsis thaliana At5g64810 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006281145.11e-144hypothetical protein CARUB_v10027178mg
SwissprotQ93WU91e-128WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBLR0GSB11e-144R0GSB1_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.8__2513__AT5G64810.11e-127(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM57112747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.11e-102WRKY DNA-binding protein 51